Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNUAK family SNF1-like kinase 1
LigandBDBM50447512
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1288874
IC50 5.0±n/a nM
Citation Reddy, MVAkula, BCosenza, SCAthuluridivakar, SMallireddigari, MRPallela, VRBilla, VKSubbaiah, DRBharathi, EVVasquez-Del Carpio, RPadgaonkar, ABaker, SJReddy, EP Discovery of 8-cyclopentyl-2-[4-(4-methyl-piperazin-1-yl)-phenylamino]-7-oxo-7,8-dihydro-pyrido[2,3-d]pyrimidine-6-carbonitrile (7x) as a potent inhibitor of cyclin-dependent kinase 4 (CDK4) and AMPK-related kinase 5 (ARK5). J Med Chem57:578-99 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NUAK family SNF1-like kinase 1
Name:NUAK family SNF1-like kinase 1
Synonyms:ARK5
Type:PROTEIN
Mol. Mass.:74326.51
Organism:Homo sapiens (Human)
Description:ChEMBL_1451343
Residue:661
Sequence:
MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQET
LGKGTYGKVKRATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYE
VFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLK
LENILLDDNCNIKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALG
VLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNPDRRATIEDI
ANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEV
MLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYS
SPERSESSELLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPAL
VSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRS
CVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKL
N
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50447512
NameBDBM50447512
Synonyms:CHEMBL3115681
TypeSmall organic molecule
Emp. Form.C24H27N7O
Mol. Mass.429.5175
SMILESCN1CCN(CC1)c1ccc(Nc2ncc3cc(C#N)c(=O)n(C4CCCC4)c3n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a