Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase PAK7
LigandBDBM50448771
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1294403
IC50 126±n/a nM
Citation Staben, STFeng, JALyle, KBelvin, MBoggs, JBurch, JDChua, CCCui, HDiPasquale, AGFriedman, LSHeise, CKoeppen, HKotey, AMintzer, ROh, ARoberts, DARouge, LRudolph, JTam, CWang, WXiao, YYoung, AZhang, YHoeflich, KP Back pocket flexibility provides group II p21-activated kinase (PAK) selectivity for type I 1/2 kinase inhibitors. J Med Chem57:1033-45 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase PAK7
Name:Serine/threonine-protein kinase PAK7
Synonyms:PAK7/PAK5 | Protein Kinase PAK5 | Serine/threonine-protein kinase (PAK7) | Serine/threonine-protein kinase PAK 5
Type:Protein
Mol. Mass.:80760.58
Organism:Homo sapiens (Human)
Description:Q9P286
Residue:719
Sequence:
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50448771
NameBDBM50448771
Synonyms:CHEMBL3128042
TypeSmall organic molecule
Emp. Form.C22H26N6O2
Mol. Mass.406.4808
SMILESCOCCNc1nc2ccc(cc2n1-c1ccnc(N)n1)C#CC1(O)CCCCC1
Structure
n/a