Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase 3A1 (ALDH3A1)
LigandBDBM50448791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1295316
IC50 1600±n/a nM
Citation Kimble-Hill, ACParajuli, BChen, CHMochly-Rosen, DHurley, TD Development of selective inhibitors for aldehyde dehydrogenases based on substituted indole-2,3-diones. J Med Chem57:714-22 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase 3A1 (ALDH3A1)
Name:Aldehyde dehydrogenase 3A1 (ALDH3A1)
Synonyms:Aldehyde dehydrogenase family 3 member A1 (ALDH3A1) | Aldehyde dehydrogenase family 3 member A1 (ALDH3A1) (Q122A)
Type:Protein
Mol. Mass.:50394.38
Organism:Homo sapiens (Human)
Description:n/a
Residue:453
Sequence:
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50448791
n/a
NameBDBM50448791
Synonyms:CHEMBL467081
TypeSmall organic molecule
Emp. Form.C21H18N4O4
Mol. Mass.390.392
SMILESO=C1N(CN2CCN(CN3C(=O)C(=O)c4ccccc34)C2)c2ccccc2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: