Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50001975
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304036
Ki 195±n/a nM
Citation Peng, YKeenan, SMZhang, QKholodovych, VWelsh, WJ 3D-QSAR comparative molecular field analysis on opioid receptor antagonists: pooling data from different studies. J Med Chem48:1620-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:MOR-1 | MUOR1 | Mu-type opioid receptor (MOR) | OPIATE Mu | Opiate non-selective | Opioid receptor B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44503.11
Organism:Rattus norvegicus (rat)
Description:Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the mu opioid receptor.
Residue:398
Sequence:
MDSSTGPGNTSDCSDPLAQASCSPAPGSWLNLSHVDGNQSDPCGLNRTGLGGNDSLCPQT
GSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATST
LPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRT
PRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFA
FIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
IIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSTIEQ
QNSTRVRQNTREHPSTANTVDRTNHQLENLEAETAPLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001975
n/a
NameBDBM50001975
Synonyms:CHEMBL193586
TypeSmall organic molecule
Emp. Form.C26H23BrN2O3
Mol. Mass.491.376
SMILES[H][C@@]12Oc3c4c(CC5N(C)CCC14[C@@]5(O)Cc1cc(cnc21)-c1ccc(Br)cc1)ccc3O |THB:3:4:13:8.11.10,14:13:4.5.6:8.11.10,9:8:13:4.5.6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: