Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM50004770
Substrate/Competitorn/a
Meas. Tech.ChEMBL_936352
Ki 0.66±n/a nM
Citation Bonifazi, APiergentili, ADel Bello, FFarande, YGiannella, MPigini, MAmantini, CNabissi, MFarfariello, VSantoni, GPoggesi, ELeonardi, AMenegon, SQuaglia, W Structure-activity relationships in 1,4-benzodioxan-related compounds. 11. (1) reversed enantioselectivity of 1,4-dioxane derivatives ina1-adrenergic and 5-HT1A receptor binding sites recognition. J Med Chem56:584-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004770
NameBDBM50004770
Synonyms:CHEMBL2312227
TypeSmall organic molecule
Emp. Form.C26H29NO4
Mol. Mass.419.5128
SMILESCOc1ccccc1OCCNCC1COCC(O1)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a