Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIndolethylamine N-methyltransferase
LigandBDBM50000303
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1333667
IC50 1600±n/a nM
Citation Rokach, JHamel, PHunter, NRReader, GRooney, CSAnderson, PSCragoe, EJMandel, LR Cyclic amidine inhibitors of indolamine N-methyltransferase. J Med Chem22:237-47 (1979) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Indolethylamine N-methyltransferase
Name:Indolethylamine N-methyltransferase
Synonyms:Amine N-methyltransferase | Aromatic alkylamine N-methyltransferase | Arylamine N-methyltransferase | INMT | Indolamine N-methyltransferase | Thioether S-methyltransferase
Type:PROTEIN
Mol. Mass.:28949.17
Organism:Oryctolagus cuniculus
Description:ChEMBL_108264
Residue:263
Sequence:
MEGGFTGGDEYQKHFLPRDYLNTYYSFQSGPSPEAEMLKFNLECLHKTFGPGGLQGDTLI
DIGSGPTIYQVLAACESFKDITLSDFTDRNREELAKWLKKEPGAYDWTPALKFACELEGN
SGRWQEKAEKLRATVKRVLKCDANLSNPLTPVVLPPADCVLTLLAMECACCSLDAYRAAL
RNLASLLKPGGHLVTTVTLQLSSYMVGEREFSCVALEKEEVEQAVLDAGFDIEQLLYSPQ
SYSASTAPNRGVCFLVARKKPGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000303
NameBDBM50000303
Synonyms:CHEMBL3228386
TypeSmall organic molecule
Emp. Form.C6H9ClN2
Mol. Mass.144.602
SMILESCl.Cn1ccccc1=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a