Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIndolethylamine N-methyltransferase
LigandBDBM50000123
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1333668
IC50 6700±n/a nM
Citation Rokach, JHamel, PHunter, NRReader, GRooney, CSAnderson, PSCragoe, EJMandel, LR Cyclic amidine inhibitors of indolamine N-methyltransferase. J Med Chem22:237-47 (1979) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Indolethylamine N-methyltransferase
Name:Indolethylamine N-methyltransferase
Synonyms:Amine N-methyltransferase | Aromatic alkylamine N-methyltransferase | Arylamine N-methyltransferase | Indolamine N-methyltransferase
Type:PROTEIN
Mol. Mass.:28884.19
Organism:Homo sapiens (Human)
Description:ChEMBL_1333668
Residue:263
Sequence:
MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLI
DIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGN
SGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAAL
CNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQ
SYSVTNAANNGVCFIVARKKPGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000123
NameBDBM50000123
Synonyms:CHEMBL3228364
TypeSmall organic molecule
Emp. Form.C4H6N2S
Mol. Mass.114.169
SMILESCn1ccsc1=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a