Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled bile acid receptor 1
LigandBDBM50003559
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1335565
EC50 1.000000±n/a nM
Citation Phillips, DPGao, WYang, YZhang, GLerario, IKLau, TLJiang, JWang, XNguyen, DGBhat, BGTrotter, CSullivan, HWelzel, GLandry, JChen, YJoseph, SBLi, CGordon, WPRichmond, WJohnson, KBretz, ABursulaya, BPan, SMcNamara, PSeidel, HM Discovery of trifluoromethyl(pyrimidin-2-yl)azetidine-2-carboxamides as potent, orally bioavailable TGR5 (GPBAR1) agonists: structure-activity relationships, lead optimization, and chronic in vivo efficacy. J Med Chem57:3263-82 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled bile acid receptor 1
Name:G-protein coupled bile acid receptor 1
Synonyms:BG37 | M-BAR | TGR5 | hBG37 | hGPCR19
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:35260.02
Organism:Homo sapiens (human)
Description:CHO cells transiently transfected with hTGR5.
Residue:330
Sequence:
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003559
NameBDBM50003559
Synonyms:CHEMBL3234570
TypeSmall organic molecule
Emp. Form.C27H32F3N7O2
Mol. Mass.543.5839
SMILESFC(F)(F)c1nc(cc(n1)N1CCC[C@H](C1)C(=O)NCCc1ccc(cc1)C#N)N1CCN(CC1)C1COC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a