Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdvanced glycosylation end product-specific receptor
LigandBDBM50005634
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1339877
Kd 43000±n/a nM
Citation Han, YTKim, KChoi, GIAn, HSon, DKim, HHa, HJSon, JHChung, SJPark, HJLee, JSuh, YG Pyrazole-5-carboxamides, novel inhibitors of receptor for advanced glycation end products (RAGE). Eur J Med Chem79:128-42 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Advanced glycosylation end product-specific receptor
Name:Advanced glycosylation end product-specific receptor
Synonyms:AGER | RAGE | Receptor for advanced glycosylation end products
Type:PROTEIN
Mol. Mass.:42800.11
Organism:Homo sapiens
Description:ChEMBL_1339877
Residue:404
Sequence:
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005634
NameBDBM50005634
Synonyms:CHEMBL3235375
TypeSmall organic molecule
Emp. Form.C34H41FN4O4
Mol. Mass.588.7121
SMILESCCCCOc1cc(OCCCN(CC)CC)ccc1NC(=O)c1cc(nn1C)-c1ccc(Oc2ccc(F)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a