Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 receptor
LigandBDBM50006739
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1336216
Ki 1.4±n/a nM
Citation Savall, BMChavez, FTays, KDunford, PJCowden, JMHack, MDWolin, RLThurmond, RLEdwards, JP Discovery and SAR of 6-alkyl-2,4-diaminopyrimidines as histamine H4 receptor antagonists. J Med Chem57:2429-39 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 receptor
Name:Histamine H4 receptor
Synonyms:AXOR35 | G-protein coupled receptor 105 | GPRv53 | HH4R | HISTAMINE H4 | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44517.02
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH4R receptors.
Residue:390
Sequence:
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006739
NameBDBM50006739
Synonyms:CHEMBL3236552
TypeSmall organic molecule
Emp. Form.C14H23N5
Mol. Mass.261.3659
SMILESCN1CCN(CC1)c1cc(nc(N)n1)C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a