Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNAD-dependent deacetylase sirtuin 2
LigandBDBM50008864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1337160
IC50 9800±n/a nM
Citation Khanfar, MAQuinti, LWang, HChoi, SHKazantsev, AGSilverman, RB Development and characterization of 3-(benzylsulfonamido)benzamides as potent and selective SIRT2 inhibitors. Eur J Med Chem76:414-26 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NAD-dependent deacetylase sirtuin 2
Name:NAD-dependent deacetylase sirtuin 2
Synonyms:NAD-Dependent Deacetylase Sirtuin-2 | NAD-dependent deacetylase sirtuin 3 | NAD-dependent protein deacetylase sirtuin-2 (SIRT2) | SIR2-like | SIR2-like protein 2 | SIRT2 | Sirtuin 2 (SIRT2)
Type:Hydrolase
Mol. Mass.:43172.62
Organism:Homo sapiens (Human)
Description:n/a
Residue:389
Sequence:
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50008864
NameBDBM50008864
Synonyms:CHEMBL3236969
TypeSmall organic molecule
Emp. Form.C21H19ClN2O5S2
Mol. Mass.478.969
SMILESCN(c1ccc(Cl)cc1)S(=O)(=O)c1cccc(c1)C(=O)Nc1ccc(cc1)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a