Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate kinase 3 alpha like 1
LigandBDBM50010316
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1340551
Ki 6200000±n/a nM
Citation Hampton, APicker, D Design of species- or isozyme-specific enzyme inhibitors. 3. Species and isozymic differences between mammalian and bacterial adenylate kinases in substituent tolerance in an enzyme-substrate complex. J Med Chem22:1529-32 (1980) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenylate kinase 3 alpha like 1
Name:Adenylate kinase 3 alpha like 1
Synonyms:AK 3 | Adenylate kinase 3 | Adenylate kinase 3 alpha-like 1 | GTP:AMP phosphotransferase mitochondrial
Type:PROTEIN
Mol. Mass.:25443.58
Organism:Rattus norvegicus
Description:ChEMBL_1340551
Residue:227
Sequence:
MGASGRLLRAVIMGAPGSGKGTGSSRITKHFELKHLSSGDLLRQNMLQGTEIAVLAKSFI
DQGKLIPDDDMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEV
IKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQT
EPVLQYYQKKGVLETFSGTETNKIRPHVYSFLQMKVPETIQKASVTP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010316
NameBDBM50010316
Synonyms:CHEMBL3251364
TypeSmall organic molecule
Emp. Form.C17H28IN6O14P3
Mol. Mass.760.2618
SMILESO[C@@H]1[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O[C@H]([C@@H]1O)n1cnc2c(NCCCCCNC(=O)CI)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a