Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM50150766
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1352069
EC50 10.0±n/a nM
Citation de Lera Ruiz, MLim, YHZheng, J Adenosine A2A receptor as a drug discovery target. J Med Chem57:3623-50 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150766
NameBDBM50150766
Synonyms:(2R,3R,4S,5R)-2-(6-amino-2-((S)-1-hydroxy-3-phenylpropan-2-ylamino)-9H-purin-9-yl)-5-(2-ethyl-2H-tetrazol-5-yl)tetrahydrofuran-3,4-diol | (2R,3R,4S,5R)-2-[6-Amino-2-((S)-1-hydroxymethyl-2-phenyl-ethylamino)-purin-9-yl]-5-(2-ethyl-2H-tetrazol-5-yl)-tetrahydro-furan-3,4-diol | CHEMBL186113 | GW-328267
TypeSmall organic molecule
Emp. Form.C21H26N10O4
Mol. Mass.482.4957
SMILESCCn1nnc(n1)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)nc(N[C@H](CO)Cc3ccccc3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a