Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivin receptor type-1B
LigandBDBM50015640
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1349305
IC50 199±n/a nM
Citation Jin, CHKrishnaiah, MSreenu, DSubrahmanyam, VBRao, KSLee, HJPark, SJPark, HJLee, KSheen, YYKim, DK Discovery of N-((4-([1,2,4]triazolo[1,5-a]pyridin-6-yl)-5-(6-methylpyridin-2-yl)-1H-imidazol-2-yl)methyl)-2-fluoroaniline (EW-7197): a highly potent, selective, and orally bioavailable inhibitor of TGF- type I receptor kinase as cancer immunotherapeutic/antifibrotic agent. J Med Chem57:4213-38 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Activin receptor type-1B
Name:Activin receptor type-1B
Synonyms:ACVR1B
Type:PROTEIN
Mol. Mass.:56810.99
Organism:Homo sapiens
Description:ChEMBL_587064
Residue:505
Sequence:
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015640
n/a
NameBDBM50015640
Synonyms:GALUNISERTIB | LY-2157299
TypeSmall organic molecule
Emp. Form.C22H19N5O
Mol. Mass.369.4192
SMILESCc1cccc(n1)-c1nn2CCCc2c1-c1ccnc2ccc(cc12)C(N)=O |(13.61,.14,;12.84,-1.19,;13.61,-2.53,;12.84,-3.86,;11.3,-3.86,;10.53,-2.53,;11.3,-1.19,;8.99,-2.53,;8.08,-1.28,;6.62,-1.76,;5.15,-1.28,;4.25,-2.53,;5.15,-3.77,;6.62,-3.3,;8.08,-3.77,;8.56,-5.24,;10.06,-5.56,;10.54,-7.02,;9.51,-8.17,;8,-7.85,;6.97,-8.99,;5.47,-8.67,;4.99,-7.21,;6.02,-6.06,;7.53,-6.38,;3.48,-6.89,;3.01,-5.42,;2.45,-8.03,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: