Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAromatic-L-amino-acid decarboxylase
LigandBDBM25525
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1363990
IC50 200000±n/a nM
Citation Cheng, PZhou, JQing, ZKang, WLiu, SLiu, WXie, HZeng, J Synthesis of 5-methyl phenanthridium derivatives: a new class of human DOPA decarboxylase inhibitors. Bioorg Med Chem Lett24:2712-6 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aromatic-L-amino-acid decarboxylase
Name:Aromatic-L-amino-acid decarboxylase
Synonyms:AADC
Type:PROTEIN
Mol. Mass.:53931.80
Organism:Homo sapiens
Description:ChEMBL_83
Residue:480
Sequence:
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25525
NameBDBM25525
Synonyms:24-methyl-5,7,18,20-tetraoxa-24-azahexacyclo[11.11.0.0^{2,10}.0^{4,8}.0^{14,22}.0^{17,21}]tetracosa-1(13),2,4(8),9,11,14(22),15,17(21),23-nonaen-24-ium | CHEMBL490129 | Pseudochelerythrine | Veadent | cid_5154 | sanguinarine | sangvinarin
TypeSmall organic molecule
Emp. Form.C20H14NO4
Mol. Mass.332.3289
SMILESC[n+]1cc2c3OCOc3ccc2c2ccc3cc4OCOc4cc3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a