Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM31892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365628
EC50 120±n/a nM
Citation Atigadda, VRXia, GDesphande, ABoerma, LJLobo-Ruppert, SGrubbs, CJSmith, CDBrouillette, WJMuccio, DD Methyl substitution of a rexinoid agonist improves potency and reveals site of lipid toxicity. J Med Chem57:5370-80 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Retinoic acid receptor RXR-alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Nuclear receptor subfamily 4 group A member 2 | Nuclear receptor subfamily 4 group A member 2/Retinoic acid receptor RXR-alpha | Retinoic acid receptor RXR-alpha/gamma | Retinoid X receptor alpha | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31892
NameBDBM31892
Synonyms:9-cis retinoic acid | 9C-RA | CHEMBL705 | Panretin | alitretinoin
TypeSmall organic molecule
Emp. Form.C20H28O2
Mol. Mass.300.4351
SMILESC\C(\C=C\C1=C(C)CCCC1(C)C)=C\C=C\C(\C)=C\C(O)=O |c:4|
Structure
n/a