Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM50018004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365631
EC50 440±n/a nM
Citation Atigadda, VRXia, GDesphande, ABoerma, LJLobo-Ruppert, SGrubbs, CJSmith, CDBrouillette, WJMuccio, DD Methyl substitution of a rexinoid agonist improves potency and reveals site of lipid toxicity. J Med Chem57:5370-80 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Retinoic acid receptor RXR-alpha
Synonyms:NR2B Channel Blocker | Retinoic acid receptor RXR-alpha | Retinoid X receptor alpha
Type:Enzyme Catalytic Domain
Mol. Mass.:51273.78
Organism:RAT
Description:NR2B Channel Blocker 0 RAT::Q05343
Residue:467
Sequence:
MDTKHFLPLDFSTQVNSSSLSSPTGRGSMAAPSLHPSLGPGLGSPLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFETGSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGNMSSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50018004
NameBDBM50018004
Synonyms:CHEMBL3289657
TypeSmall organic molecule
Emp. Form.C21H24O2
Mol. Mass.308.4141
SMILESC/C(/C=C/C=C(/C)\C=C1/CCCc2c(C)cccc12)=C\C(O)=O
Structure
n/a