Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM86453
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1362119
Ki 1995±n/a nM
Citation Jacobsen, JRAggen, JBChurch, TJKlein, UPfeiffer, JWPulido-Rios, TMThomas, GRYu, CMoran, EJ Multivalent design of long-acting▀(2)-adrenoceptor agonists incorporating biarylamines. Bioorg Med Chem Lett24:2625-30 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86453
NameBDBM86453
Synonyms:CAS_73573-87-2 | Formoterol | NSC_3083544
TypeSmall organic molecule
Emp. Form.C19H24N2O4
Mol. Mass.344.4049
SMILESCOc1ccc(CC(C)NCC(O)c2ccc(O)c(NC=O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM86453
Synonyms:CAS_73573-87-2 | Formoterol | NSC_3083544
TypeSmall organic molecule
Emp. Form.C19H24N2O4
Mol. Mass.344.4049
SMILESCOc1ccc(CC(C)NCC(O)c2ccc(O)c(NC=O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: