Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM50020938
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1365047
Kd<5.0±n/a nM
Citation Koehler, MFBergeron, PChoo, EFLau, KNdubaku, CDudley, DGibbons, PSleebs, BERye, CSNikolakopoulos, GBui, CKulasegaram, SKersten, WJSmith, BJCzabotar, PEColman, PMHuang, DCBaell, JBWatson, KGHasvold, LTao, ZFWang, LSouers, AJElmore, SWFlygare, JAFairbrother, WJLessene, G Structure-Guided Rescaffolding of Selective Antagonists of BCL-XL. ACS Med Chem Lett5:662-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020938
NameBDBM50020938
Synonyms:CHEMBL3287301
TypeSmall organic molecule
Emp. Form.C30H26N4O4S2
Mol. Mass.570.682
SMILESOC(=O)c1nc(sc1CCCOc1ccccc1)N1CCc2cccc(C(=O)Nc3nc4ccccc4s3)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a