Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine transporters; Norepininephrine & dopamine
LigandBDBM50025215
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1442871
EC50>10000±n/a nM
Citation Blough, BELandavazo, APartilla, JSDecker, AMPage, KMBaumann, MHRothman, RB Alpha-ethyltryptamines as dual dopamine-serotonin releasers. Bioorg Med Chem Lett24:4754-8 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine transporters; Norepininephrine & dopamine
Name:Monoamine transporters; Norepininephrine & dopamine
Synonyms:DA transporter | Sodium-dependent dopamine transporter | Sodium-dependent dopamine transporter (DAT)
Type:Multi-pass membrane protein
Mol. Mass.:68749.45
Organism:Rattus norvegicus (rat)
Description:P23977
Residue:619
Sequence:
MSKSKCSVGPMSSVVAPAKESNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEAQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHASNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDH
QLVDRGEVRQFTLRHWLLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025215
NameBDBM50025215
Synonyms:CHEMBL3330641
TypeSmall organic molecule
Emp. Form.C11H14N2
Mol. Mass.174.2423
SMILESCn1cc(CCN)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a