Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 1
LigandBDBM50029044
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1435499
Ki 7.2±n/a nM
Citation Yoshida, YTerauchi, TNaoe, YKazuta, YOzaki, FBeuckmann, CTNakagawa, MSuzuki, MKushida, ITakenaka, OUeno, TYonaga, M Design, synthesis, and structure-activity relationships of a series of novel N-aryl-2-phenylcyclopropanecarboxamide that are potent and orally active orexin receptor antagonists. Bioorg Med Chem22:6071-88 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 1
Name:Orexin receptor type 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029044
NameBDBM50029044
Synonyms:CHEMBL3343242
TypeSmall organic molecule
Emp. Form.C25H25NO4
Mol. Mass.403.4703
SMILESCOc1ccc(OC[C@]2(C[C@H]2C(=O)Nc2ccccc2)c2ccccc2)cc1OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a