Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstrogen-related receptor gamma
LigandBDBM20608
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1434940
IC50 1350±n/a nM
Citation Gege, CSchlüter, THoffmann, T Identification of the first inverse agonist of retinoid-related orphan receptor (ROR) with dual selectivity for RORß and ROR¿t. Bioorg Med Chem Lett24:5265-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estrogen-related receptor gamma
Name:Estrogen-related receptor gamma
Synonyms:ERR gamma-2 | Estrogen receptor-related protein 3 | Nuclear receptor subfamily 3 group B member 3
Type:PROTEIN
Mol. Mass.:51305.00
Organism:Homo sapiens (Human)
Description:ChEMBL_1501351
Residue:458
Sequence:
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20608
NameBDBM20608
Synonyms:4-Hydroxytamoxifen | 4-Hydroxytamoxifen (9) | 4-[(1Z)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl]phenol | AFIMOXIFENE | CHEMBL489 | [3H]4-OHT | cid_449459
TypeSmall organic molecule
Emp. Form.C26H29NO2
Mol. Mass.387.514
SMILESCC\C(=C(/c1ccc(O)cc1)c1ccc(OCCN(C)C)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a