Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-binding cassette sub-family G member 2
LigandBDBM50030737
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437089
EC50 400±n/a nM
Citation Krauze, AGrinberga, SKrasnova, LAdlere, ISokolova, EDomracheva, IShestakova, IAndzans, ZDuburs, G Thieno[2,3-b]pyridines--a new class of multidrug resistance (MDR) modulators. Bioorg Med Chem22:5860-70 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATP-binding cassette sub-family G member 2
Name:ATP-binding cassette sub-family G member 2
Synonyms:ABCP | ATP-Binding Cassette Transporter ABCG2 | ATP-binding cassette sub-family G member 2 | ATP-binding cassette transporter (ABCG2) | ATP-binding cassette, sub-family G, member 2 | BCRP | BCRP1 | Breast cancer resistance protein | CDw338 | MXR | Mitoxantrone resistance-associated protein | Placenta-specific ATP-binding cassette transporter | Urate exporter
Type:Multi-pass membrane protein; monomer or homodimer; disulfide-linked
Mol. Mass.:72329.48
Organism:Homo sapiens (Human)
Description:Q9UNQ0
Residue:655
Sequence:
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030737
NameBDBM50030737
Synonyms:CHEMBL3342121
TypeSmall organic molecule
Emp. Form.C30H32N2O7S
Mol. Mass.564.649
SMILESCCCCOC(=O)c1c(C)nc2sc(C(=O)c3ccc(OC)cc3)c(N)c2c1-c1cc(OC)c(OC)c(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a