Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATPase family AAA domain-containing protein 2
LigandBDBM50030951
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1442444
Kd 400000±n/a nM
Citation Harner, MJChauder, BAPhan, JFesik, SW Fragment-based screening of the bromodomain of ATAD2. J Med Chem57:9687-92 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATPase family AAA domain-containing protein 2
Name:ATPase family AAA domain-containing protein 2
Synonyms:AAA nuclear coregulator cancer-associated protein | ANCCA | ATAD2 | PRO2000
Type:PROTEIN
Mol. Mass.:158546.30
Organism:Homo sapiens (Human)
Description:ChEMBL_1500426
Residue:1390
Sequence:
MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGS
SVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEE
HREDKVIPVTRSLRARNIVQSTEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNT
AEAVLQKMDDMKKMRRQRMRELEDLGVFNETEESNLNMYTRGKQKDIQRTDEETTDNQEG
SVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDDEDEEDGEEENQKRYYLRQRK
ATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNRRRHAIHSSDS
TSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARAL
ANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVR
SSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPD
KEARKEILKIHTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYT
TSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEAL
QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHL
NRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPH
SALPEEVQELFIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLP
VAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD
YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACA
LRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSD
PEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHKIES
DTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILS
QPTPSLVVDHERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKME
QEVENFSCSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030951
NameBDBM50030951
Synonyms:CHEMBL389723
TypeSmall organic molecule
Emp. Form.C13H9N3O
Mol. Mass.223.2301
SMILESc1ccc(cc1)-c1nnc(o1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a