Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNon-receptor tyrosine-protein kinase TYK2
LigandBDBM50032624
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1440960
Ki 36±n/a nM
Citation Hanan, EJEigenbrot, CBryan, MCBurdick, DJChan, BKChen, YDotson, JHeald, RAJackson, PSLa, HLainchbury, MDMalek, SPurkey, HESchaefer, GSchmidt, SSeward, EMSideris, STam, CWang, SYeap, SKYen, IYin, JYu, CZilberleyb, IHeffron, TP Discovery of selective and noncovalent diaminopyrimidine-based inhibitors of epidermal growth factor receptor containing the T790M resistance mutation. J Med Chem57:10176-91 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Non-receptor tyrosine-protein kinase TYK2
Name:Non-receptor tyrosine-protein kinase TYK2
Synonyms:Non-receptor tyrosine-protein kinase TYK2 (TYK2) | TYK2 | Tyrosine-protein kinase TYK2
Type:Protein
Mol. Mass.:133666.03
Organism:Homo sapiens (Human)
Description:P29597
Residue:1187
Sequence:
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032624
NameBDBM50032624
Synonyms:CHEMBL3354186
TypeSmall organic molecule
Emp. Form.C20H22N8O
Mol. Mass.390.4417
SMILESCOC1CCN(CC1)c1nccc(Nc2cc3[nH]c(cc3cn2)-c2cn[nH]c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a