Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPA-I galactophilic lectin
LigandBDBM50034082
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1436493
Kd 176±n/a nM
Citation Boukerb, AMRousset, AGalanos, NMéar, JBThépaut, MGrandjean, TGillon, ECecioni, SAbderrahmen, CFaure, KRedelberger, DKipnis, EDessein, RHavet, SDarblade, BMatthews, SEde Bentzmann, SGuéry, BCournoyer, BImberty, AVidal, S Antiadhesive properties of glycoclusters against Pseudomonas aeruginosa lung infection. J Med Chem57:10275-89 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PA-I galactophilic lectin
Name:PA-I galactophilic lectin
Synonyms:Galactose-binding lectin | PA-I galactophilic lectin | PA-IL | lecA | pa1L
Type:PROTEIN
Mol. Mass.:12891.24
Organism:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG12228)
Description:ChEMBL_109520
Residue:122
Sequence:
MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHD
AFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKD
QS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034082
NameBDBM50034082
Synonyms:CHEMBL3358626
TypeSmall organic molecule
Emp. Form.C104H156N12O35
Mol. Mass.2134.4108
SMILESC[C@H]1O[C@@H](OCCOCCOCCn2cc(COc3c4Cc5cc(cc(Cc6cc(cc(Cc7cc(cc(Cc3cc(c4)C(C)(C)C)c7OCc3cn(CCOCCOCCO[C@@H]4O[C@H](CO)[C@H](O)[C@H](O)[C@H]4O)nn3)C(C)(C)C)c6OCc3cn(CCOCCOCCO[C@@H]4O[C@H](CO)[C@H](O)[C@H](O)[C@H]4O)nn3)C(C)(C)C)c5OCc3cn(CCOCCOCCO[C@@H]4O[C@H](CO)[C@H](O)[C@H](O)[C@H]4O)nn3)C(C)(C)C)nn2)[C@H](O)[C@@H](O)[C@H]1O |r|
Structure
n/a