Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor beta (LXRB)
LigandBDBM50034791
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441019
EC50 2.0±n/a nM
Citation Kick, EMartin, RXie, YFlatt, BSchweiger, EWang, TLBusch, BNyman, MGu, XHYan, GWagner, BNanao, MNguyen, LStout, TPlonowski, ASchulman, IOstrowski, JKirchgessner, TWexler, RMohan, R Liver X receptor (LXR) partial agonists: biaryl pyrazoles and imidazoles displaying a preference for LXR. Bioorg Med Chem Lett25:372-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor beta (LXRB)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Oxysterols receptor LXR-beta
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034791
NameBDBM50034791
Synonyms:CHEMBL3360960
TypeSmall organic molecule
Emp. Form.C25H15F5N2O3S2
Mol. Mass.550.52
SMILESCS(=O)(=O)c1cccc(c1)-c1ccc(s1)-c1cc(c(C#N)c(=O)n1Cc1ccc(F)cc1F)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a