Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50034790
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1441018
EC50 20±n/a nM
Citation Kick, EMartin, RXie, YFlatt, BSchweiger, EWang, TLBusch, BNyman, MGu, XHYan, GWagner, BNanao, MNguyen, LStout, TPlonowski, ASchulman, IOstrowski, JKirchgessner, TWexler, RMohan, R Liver X receptor (LXR) partial agonists: biaryl pyrazoles and imidazoles displaying a preference for LXR. Bioorg Med Chem Lett25:372-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X Receptor alpha (LXR-alpha) | Liver X receptor alpha | Liver X receptor alpha (LXRA) | Liver X receptor alpha (NR1H3) | Liver X, LXR alpha | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:50403.85
Organism:Homo sapiens (human)
Description:His-tagged hLXR.
Residue:447
Sequence:
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034790
NameBDBM50034790
Synonyms:CHEMBL3360961
TypeSmall organic molecule
Emp. Form.C26H15F5N2O2
Mol. Mass.482.4015
SMILESFc1ccc(Cn2c(cc(c(C#N)c2=O)C(F)(F)F)-c2ccc(Oc3ccccc3)cc2)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a