Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine-5-monophosphate dehydrogenase (IMPDH)
LigandBDBM50040479
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1443968
IC50 190±n/a nM
Citation Sun, ZKhan, JMakowska-Grzyska, MZhang, MCho, JHSuebsuwong, CVo, PGollapalli, DRKim, YJoachimiak, AHedstrom, LCuny, GD Synthesis, in vitro evaluation and cocrystal structure of 4-oxo-[1]benzopyrano[4,3-c]pyrazole Cryptosporidium parvum inosine 5'-monophosphate dehydrogenase (CpIMPDH) inhibitors. J Med Chem57:10544-50 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine-5-monophosphate dehydrogenase (IMPDH)
Name:Inosine-5-monophosphate dehydrogenase (IMPDH)
Synonyms:Cgd6_20 protein | Inosine-5''-monophosphate dehydrogenase, probable
Type:Protein
Mol. Mass.:43076.80
Organism:Cryptosporidium parvum
Description:Q8T6T2
Residue:400
Sequence:
MGTKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAV
GMARLGGIGIIHKNMDMESQVNEVLKVKNWISNLEKNESTPDQNLDKESTDGKDTKSNNN
IDAYSNENLDNKGRLRVGAAIGVNEIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIK
SKMNIDVIVGNVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGVPQITAIEKCSS
VASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYYR
GMGSVGAMKSGSGDRYFQEKRPENKMVPEGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLG
SASIEELWKKSSYVEITTSGLRESHVHDVEIVKEVMNYSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040479
NameBDBM50040479
Synonyms:CHEMBL3360629
TypeSmall organic molecule
Emp. Form.C20H15N3O5
Mol. Mass.377.3502
SMILESO=C(Cn1ncc2c1c1ccccc1oc2=O)Nc1ccc2OCCOc2c1
Structure
n/a