Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 3
LigandBDBM50041691
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1446121
EC50>10000±n/a nM
Citation Buzard, DJKim, SHLopez, LKawasaki, AZhu, XMoody, JThoresen, LCalderon, IUllman, BHan, SLehmann, JGharbaoui, TSengupta, DCalvano, LMontalban, AGMa, YASage, CGao, YSemple, GEdwards, JBarden, JMorgan, MChen, WUsmani, KChen, CSadeque, AChristopher, RJThatte, JFu, LSolomon, MMills, DWhelan, KAl-Shamma, HGatlin, JLe, MGaidarov, IAnthony, TUnett, DJBlackburn, ARueter, JStirn, SBehan, DPJones, RM Discovery of APD334: Design of a Clinical Stage Functional Antagonist of the Sphingosine-1-phosphate-1 Receptor. ACS Med Chem Lett5:1313-7 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 3
Name:Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Synonyms:EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42278.13
Organism:Homo sapiens (Human)
Description:Q99500
Residue:378
Sequence:
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041691
NameBDBM50041691
Synonyms:CHEMBL3358920
TypeSmall organic molecule
Emp. Form.C26H26F3NO3
Mol. Mass.457.4847
SMILESOC(=O)C[C@H]1CCc2c1[nH]c1ccc(OCc3ccc(C4CCCC4)c(c3)C(F)(F)F)cc21 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a