Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V1b receptor
LigandBDBM50205308
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1451729
EC50 11±n/a nM
Citation Wisniewski, KAlagarsamy, SGalyean, RTariga, HThompson, DLy, BWisniewska, HQi, SCroston, GLaporte, RRivière, PJSchteingart, CD New, potent, and selective peptidic oxytocin receptor agonists. J Med Chem57:5306-17 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V1b receptor
Name:Vasopressin V1b receptor
Synonyms:AVPR V1b | AVPR V3 | Antidiuretic hormone receptor 1b | V1bR | VASOPRESSIN V1B | Vasopressin V3 | Vasopressin V3 receptor
Type:Enzyme
Mol. Mass.:46985.01
Organism:Homo sapiens (Human)
Description:P47901
Residue:424
Sequence:
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
TIIF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205308
NameBDBM50205308
Synonyms:(S)-1-((4R,7S,10S,13S,16S)-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-13-benzyl-16-(4-hydroxybenzyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosane-4-carbonyl)-N-((R)-1-(2-amino-2-oxoethylamino)-5-guanidino-1-oxopentan-2-yl)pyrrolidine-2-carboxamide | CHEMBL1429 | DESMOPRESSIN | US10131692, Compound 42 (dDAVP) | dDAVP
TypeSmall organic molecule
Emp. Form.C46H64N14O12S2
Mol. Mass.1069.217
SMILES[#7]-[#6](=O)-[#6]-[#6]-[#6@@H]-1-[#7]-[#6](=O)-[#6@H](-[#6]-c2ccccc2)-[#7]-[#6](=O)-[#6@H](-[#6]-c2ccc(-[#8])cc2)-[#7]-[#6](=O)-[#6]-[#6]-[#16]-[#16]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#7])=O)-[#7]-[#6]-1=O)-[#6](=O)-[#7]-1-[#6]-[#6]-[#6]-[#6@H]-1-[#6](=O)-[#7]-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](=O)-[#7]-[#6]-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a