Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransient receptor potential cation channel subfamily M member 5
LigandBDBM50044849
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1456208
EC50<50119±n/a nM
Citation Sparks, SMChen, GCollins, JLDanger, DDock, STJayawickreme, CJenkinson, SLaudeman, CLeesnitzer, MALiang, XMaloney, PMcCoy, DCMoncol, DRash, VRimele, TVulimiri, PWay, JMRoss, S Identification of diarylsulfonamides as agonists of the free fatty acid receptor 4 (FFA4/GPR120). Bioorg Med Chem Lett24:3100-3 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transient receptor potential cation channel subfamily M member 5
Name:Transient receptor potential cation channel subfamily M member 5
Synonyms:LTRPC5 | LTrpC-5 | LTrpC5 | Long transient receptor potential channel 5 | MLSN1- and TRP-related gene 1 protein | MTR1 | TRPM5 | Transient receptor potential cation channel subfamily M member 5
Type:PROTEIN
Mol. Mass.:131454.24
Organism:Homo sapiens
Description:ChEMBL_103787
Residue:1165
Sequence:
MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEW
HLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAV
RDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNL
SHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERI
SRAVEQAAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWT
KLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDR
VDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQELYR
SVSRKSLLFDLLQRKQEEARLTLAGLGTQQAREPPAGPPAFSLHEVSRVLKDFLQDACRG
FYQDGRPGDRRRAEKGPAKRPTGQKWLLDLNQKSENPWRDLFLWAVLQNRHEMATYFWAM
GQEGVAAALAACKILKEMSHLETEAEAARATREAKYERLALDLFSECYSNSEARAFALLV
RRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLLGAFLCPALV
YTNLITFSEEAPLRTGLEDLQDLDSLDTEKSPLYGLQSRVEELVEAPRAQGDRGPRAVFL
LTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGPEVTLYFWVFTLVL
EEIRQGFFTDEDTHLVKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLPSAFEAGRTVLAM
DFMVFTLRLIHIFAIHKQLGPKIIVVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDG
RLEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLV
TFLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHL
SLTLRRVFKKEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRK
TAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLVSSVADVLAQGGGPRSSQHCGEGSQ
LVAADHRGGLDGWEQPGAGQPPSDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50044849
NameBDBM50044849
Synonyms:CHEMBL3311308
TypeSmall organic molecule
Emp. Form.C16H19NO3S
Mol. Mass.305.392
SMILESCOc1ccc(cc1)S(=O)(=O)Nc1c(C)cc(C)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a