Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM2579
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1458485
IC50 1.000000±n/a nM
Citation Song, DPark, YYoon, JAman, WHah, JMRyu, JS Click approach to the discovery of 1,2,3-triazolylsalicylamides as potent Aurora kinase inhibitors. Bioorg Med Chem22:4855-66 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2579
NameBDBM2579
Synonyms:(2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-29-oxa-1,7,17-triazaoctacyclo[12.12.2.1^{2,6}.0^{7,28}.0^{8,13}.0^{15,19}.0^{20,27}.0^{21,26}]nonacosa-8(13),9,11,14(28),15(19),20(27),21(26),22,24-nonaen-16-one | CHEMBL388978 | Staurosporin, 4 | Staurosporine | Staurosporine, 8 | US9206188, Staurosporine | US9226923, Staurosporine
TypeSmall organic molecule
Emp. Form.C28H26N4O3
Mol. Mass.466.531
SMILESCN[C@@H]1C[C@H]2O[C@@](C)([C@@H]1OC)n1c3ccccc3c3c4CNC(=O)c4c4c5ccccc5n2c4c13 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a