Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetALK2
LigandBDBM50056676
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1453224
IC50 960±n/a nM
Citation Mohedas, AHWang, YSanvitale, CECanning, PChoi, SXing, XBullock, ANCuny, GDYu, PB Structure-activity relationship of 3,5-diaryl-2-aminopyridine ALK2 inhibitors reveals unaltered binding affinity for fibrodysplasia ossificans progressiva causing mutants. J Med Chem57:7900-15 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ALK2
Name:ALK2
Synonyms:ActR-I | ActRIA | Acvr | Acvrlk2
Type:Protein
Mol. Mass.:57231.35
Organism:Mus musculus
Description:n/a
Residue:509
Sequence:
MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
AELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056676
NameBDBM50056676
Synonyms:CHEMBL3341789
TypeSmall organic molecule
Emp. Form.C25H29N3O3
Mol. Mass.419.5161
SMILESCOc1cc(cc(OC)c1OC)-c1cc(cnc1C)-c1ccc(cc1)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a