Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine-5'-monophosphate dehydrogenase, probable
LigandBDBM50398417
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1452430
IC50 4.0±n/a nM
Citation Mandapati, KGorla, SKHouse, ALMcKenney, ESZhang, MRao, SNGollapalli, DRMann, BJGoldberg, JBCuny, GDGlomski, IJHedstrom, L Repurposing cryptosporidium inosine 5'-monophosphate dehydrogenase inhibitors as potential antibacterial agents. ACS Med Chem Lett5:846-50 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine-5'-monophosphate dehydrogenase, probable
Name:Inosine-5-monophosphate dehydrogenase (IMPDH)
Synonyms:Cgd6_20 protein | Inosine-5''-monophosphate dehydrogenase, probable
Type:Protein
Mol. Mass.:43076.80
Organism:Cryptosporidium parvum
Description:Q8T6T2
Residue:400
Sequence:
MGTKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAV
GMARLGGIGIIHKNMDMESQVNEVLKVKNWISNLEKNESTPDQNLDKESTDGKDTKSNNN
IDAYSNENLDNKGRLRVGAAIGVNEIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIK
SKMNIDVIVGNVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVGVPQITAIEKCSS
VASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYYR
GMGSVGAMKSGSGDRYFQEKRPENKMVPEGIEGRVKYKGEMEGVVYQLVGGLRSCMGYLG
SASIEELWKKSSYVEITTSGLRESHVHDVEIVKEVMNYSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50398417
NameBDBM50398417
Synonyms:CHEMBL2178652
TypeSmall organic molecule
Emp. Form.C20H20ClF3N2O
Mol. Mass.396.834
SMILESCC(=C)c1cccc(c1)C(C)(C)NC(=O)Nc1ccc(Cl)c(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a