Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdiponectin receptor protein 1
LigandBDBM50059083
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1461017
Kd 1800±n/a nM
Citation Rana, SBlowers, ECNatarajan, A Small molecule adenosine 5'-monophosphate activated protein kinase (AMPK) modulators and human diseases. J Med Chem58:2-29 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adiponectin receptor protein 1
Name:Adiponectin receptor protein 1
Synonyms:ADIPOR1 | Adiponectin receptor protein 1 | PAQR1 | Progestin and adipoQ receptor family member I | TESBP1A
Type:PROTEIN
Mol. Mass.:42619.21
Organism:Homo sapiens
Description:ChEMBL_109558
Residue:375
Sequence:
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDTLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50059083
n/a
NameBDBM50059083
Synonyms:CHEMBL3393145
TypeSmall organic molecule
Emp. Form.C27H28N2O3
Mol. Mass.428.5228
SMILESO=C(COc1ccc(cc1)C(=O)c1ccccc1)NC1CCN(Cc2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: