Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 14
LigandBDBM50059171
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1460845
IC50 9700±n/a nM
Citation Cumming, JGDebreczeni, JÉEdfeldt, FEvertsson, EHarrison, MHoldgate, GAJames, MJLamont, SGOldham, KSullivan, JEWells, SL Discovery and characterization of MAPK-activated protein kinase-2 prevention of activation inhibitors. J Med Chem58:278-93 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 14
Name:p38 MAP kinase alpha/beta
Synonyms:CSAID-binding protein | CSBP | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAX-interacting protein 2 | Mitogen-activated protein kinase p38 alpha | SAPK2a | Stress-activated protein kinase 2a
Type:Serine/threonine-protein kinase
Mol. Mass.:41286.76
Organism:Homo sapiens (Human)
Description:Q16539
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50059171
n/a
NameBDBM50059171
Synonyms:CHEMBL3393296
TypeSmall organic molecule
Emp. Form.C22H26N4O3S
Mol. Mass.426.532
SMILESCCCc1c(cnn1-c1ccccc1)C(=O)Nc1cc(ccc1C)S(=O)(=O)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: