Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 receptor
LigandBDBM50061098
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1461283
Ki 1.000000±n/a nM
Citation Savall, BMMeduna, SPTays, KCai, HThurmond, RLMcGovern, PGaul, MZhao, BPEdwards, JP Diaminopyrimidines, diaminopyridines and diaminopyridazines as histamine H4 receptor modulators. Bioorg Med Chem Lett25:956-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 receptor
Name:Histamine H4 receptor
Synonyms:AXOR35 | G-protein coupled receptor 105 | GPRv53 | HH4R | HISTAMINE H4 | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44517.02
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH4R receptors.
Residue:390
Sequence:
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061098
NameBDBM50061098
Synonyms:CHEMBL3393534 | US9732087, 1
TypeSmall organic molecule
Emp. Form.C17H26N4
Mol. Mass.286.4151
SMILESCN[C@@H]1CCN(C1)c1ccnc(NC2CC3CCC2C3)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a