Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPresenilin-1
LigandBDBM50322460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1462966
EC50 4600±n/a nM
Citation Flesch, DNess, JLamers, CDehm, FPopella, SSteri, ROgorek, IHieke, MDannhardt, GWerz, OWeggen, SSchubert-Zsilavecz, M SAR-studies of┐-secretase modulators with PPAR┐-agonistic and 5-lipoxygenase-inhibitory activity for Alzheimer's disease. Bioorg Med Chem Lett25:841-6 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Presenilin-1
Name:Presenilin-1
Synonyms:3.4.23.- | AD3 | Gamma-Secretase Subunit Presenilin-1 | PS-1 | PS1 | PS1-CTF12 | PSEN1 | PSNL1 | Presenilin-1 CTF subunit | Presenilin-1 CTF12 | Presenilin-1 NTF subunit | Protein S182
Type:n/a
Mol. Mass.:52657.13
Organism:Homo sapiens (Human)
Description:P49768
Residue:467
Sequence:
MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAA
VQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50322460
n/a
NameBDBM50322460
Synonyms:2-(4,6-Bis(2-cyclohexylethoxy)pyrimidin-2-ylthio)hexanoic acid | CHEMBL1171834
TypeSmall organic molecule
Emp. Form.C26H42N2O4S
Mol. Mass.478.688
SMILESCCCCC(Sc1nc(OCCC2CCCCC2)cc(OCCC2CCCCC2)n1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: