Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCystathionine beta-synthase
LigandBDBM50064291
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1464805
IC50 187000±n/a nM
Citation Thorson, MKVan Wagoner, RMHarper, MKIreland, CMMajtan, TKraus, JPBarrios, AM Marine natural products as inhibitors of cystathionine beta-synthase activity. Bioorg Med Chem Lett25:1064-6 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cystathionine beta-synthase
Name:Cystathionine beta-synthase
Synonyms:Beta-thionase | CBS | Cystathionine beta-synthase | Serine sulfhydrase
Type:PROTEIN
Mol. Mass.:60586.85
Organism:Homo sapiens (Human)
Description:ChEMBL_109567
Residue:551
Sequence:
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPA
SESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKD
RISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDV
LRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEI
LQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTT
YEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKA
AQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLS
APLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVG
KVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLL
NFVAAQERDQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064291
NameBDBM50064291
Synonyms:CHEMBL1957775
TypeSmall organic molecule
Emp. Form.C11H10N2O3S
Mol. Mass.250.274
SMILESCOc1cc(\C=C2/NC(=S)NC2=O)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a