Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium release-activated calcium channel
LigandBDBM50064640
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1465032
IC50 440±n/a nM
Citation Esteve, CGonzález, JGual, SVidal, LAlzina, SSentellas, SJover, IHorrillo, RDe Alba, JMiralpeix, MTarrasón, GVidal, B Discovery of 7-azaindole derivatives as potent Orai inhibitors showing efficacy in a preclinical model of asthma. Bioorg Med Chem Lett25:1217-22 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcium release-activated calcium channel
Name:Calcium release-activated calcium channel
Synonyms:CRACM1 | Calcium channel (VER) | Calcium release-activated calcium channel protein 1 | ORAI1 | Protein orai-1 | TMEM142A | Transmembrane protein 142A
Type:Protein
Mol. Mass.:32676.63
Organism:Homo sapiens (Human)
Description:Q96D31
Residue:301
Sequence:
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064640
NameBDBM50064640
Synonyms:CHEMBL3403753
TypeSmall organic molecule
Emp. Form.C20H15ClFN3O2
Mol. Mass.383.803
SMILESCOc1cc(OC)c(cn1)-c1cnc2[nH]c(cc2c1)-c1c(F)cccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a