Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTissue non-specific alkaline phosphatase (TNAP)
LigandBDBM50068225
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1464323
Ki 50±n/a nM
Citation Al-Rashida, MEjaz, SAAli, SShaukat, AHamayoun, MAhmed, MIqbal, J Diarylsulfonamides and their bioisosteres as dual inhibitors of alkaline phosphatase and carbonic anhydrase: Structure activity relationship and molecular modelling studies. Bioorg Med Chem23:2435-44 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tissue non-specific alkaline phosphatase (TNAP)
Name:Tissue non-specific alkaline phosphatase (TNAP)
Synonyms:ALPL | AP-TNAP | Alkaline phosphatase liver/bone/kidney isozyme | Alkaline phosphatase, tissue-nonspecific isozyme | TNSALP
Type:Protein
Mol. Mass.:57195.60
Organism:Bos taurus (Cattle)
Description:P09487
Residue:524
Sequence:
MISPFLLLAIGTCFASSLVPEKEKDPKYWRDQAQQTLKNALRLQTLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHSPGEETKLEMDKFPYVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATQRSQCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSASYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIEVIMGGGRKYMFPKNRTDVEYELDE
KARGTRLDGLNLIDIWKSFKPKHKHSHYVWNRTDLLALDPHSVDYLLGLFEPGDMQYELN
RNNATDPSLSEMVEMAIRILNKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIG
QAGAMTSVEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYAACIGANRDHCASASSSGSPSPGPLLLLLALLPLGSLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50068225
NameBDBM50068225
Synonyms:CHEMBL3403324
TypeSmall organic molecule
Emp. Form.C14H16N2O4S2
Mol. Mass.340.418
SMILESCc1ccc(cc1)S(=O)(=O)NCc1ccc(cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a