Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHeme Oxygenase 2 (HO-2)
LigandBDBM50438664
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1470661
IC50 77600±n/a nM
Citation Salerno, LPittalą, VRomeo, GModica, MNMarrazzo, ASiracusa, MASorrenti, VDi Giacomo, CVanella, LParayath, NNGreish, K Novel imidazole derivatives as heme oxygenase-1 (HO-1) and heme oxygenase-2 (HO-2) inhibitors and their cytotoxic activity in human-derived cancer cell lines. Eur J Med Chem96:162-72 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Heme Oxygenase 2 (HO-2)
Name:Heme oxygenase 2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:35754.99
Organism:Rattus norvegicus (rat)
Description:HO-2 obtained from rat brain was used in enzyme assays.
Residue:315
Sequence:
MSSEVETSEGVDESENNSTAPEKENHTKMADLSELLKEGTKEAHDRAENTQFVKDFLKGN
IKKELFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPTELHRKEALIKDMEYFFGENW
EEQVKCSEAAQKYVDRIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTG
EGTQFYLFEHVDNAQQFKQFYRARMNALDLSMKTKERIVEEANKAFEYNMQIFSELDQAG
SMLTKETLEDGLPVHDGKGDVRKCPFYAAQPDKGTLGGSNCPFRTAMAVLRKPSLQLILA
ASVALVAGLLAWYYM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50438664
NameBDBM50438664
Synonyms:CHEMBL2414447
TypeSmall organic molecule
Emp. Form.C12H13N3O3
Mol. Mass.247.2499
SMILES[O-][N+](=O)c1ccc(OCCCn2ccnc2)cc1
Structure
n/a