Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpithelial discoidin domain-containing receptor 1
LigandBDBM50399540
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1474747
Kd 0.200000±n/a nM
Citation Li, YLu, XRen, XDing, K Small molecule discoidin domain receptor kinase inhibitors and potential medical applications. J Med Chem58:3287-301 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epithelial discoidin domain-containing receptor 1
Name:Epithelial discoidin domain-containing receptor 1
Synonyms:Discoidin domain receptor 1 (DDR1) | Discoidin domain-containing receptor 1 (DDR1) | Discoidin receptor tyrosine kinase | Epithelial discoidin domain receptor 1 | Epithelial discoidin domain receptor 1 (DDR1) | HGK2 | Mammary carcinoma kinase 10 | Protein-tyrosine kinase RTK 6 | Tyrosine-protein kinase CAK
Type:Tyrosine-protein kinase
Mol. Mass.:101130.02
Organism:Homo sapiens
Description:Q08345
Residue:913
Sequence:
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399540
n/a
NameBDBM50399540
Synonyms:FORETINIB
TypeSmall organic molecule
Emp. Form.C34H34F2N4O6
Mol. Mass.632.6538
SMILESCOc1cc2c(Oc3ccc(NC(=O)C4(CC4)C(=O)Nc4ccc(F)cc4)cc3F)ccnc2cc1OCCCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: