Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArylacetamide deacetylase
LigandBDBM50131270
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1481893
Ki 600±n/a nM
Citation Kobayashi, YFukami, TNakajima, AWatanabe, ANakajima, MYokoi, T Species differences in tissue distribution and enzyme activities of arylacetamide deacetylase in human, rat, and mouse. Drug Metab Dispos40:671-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arylacetamide deacetylase
Name:Arylacetamide deacetylase
Synonyms:AADAC | Arylacetamide deacetylase | DAC
Type:PROTEIN
Mol. Mass.:45743.18
Organism:Homo sapiens
Description:ChEMBL_109673
Residue:399
Sequence:
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMD
SFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSA
ALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNP
ERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLF
LSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNP
NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTG
VQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131270
NameBDBM50131270
Synonyms:2-methyl-N-[4-nitro-3-(trifluoromethyl)phenyl]propanamide | 4'-nitro-3'-trifluoromethylisobutyranilide | CHEMBL806 | Eulexin | FLUTAMIDE | Niftolide | alpha,alpha,alpha-trifluoro-2-methyl-4'-nitro-m-propionotoluidide | niftolid
TypeSmall organic molecule
Emp. Form.C11H11F3N2O3
Mol. Mass.276.2118
SMILESCC(C)C(=O)Nc1ccc(c(c1)C(F)(F)F)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a