Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B2, mitochondrial
LigandBDBM50092137
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1498857
IC50 0.500000±n/a nM
Citation Hoyt, SBPark, MKLondon, CXiong, YTata, JBennett, DJCooke, ACai, JCarswell, ERobinson, JMacLean, JBrown, LBelshaw, SClarkson, TRLiu, KLiang, GBStruthers, MCully, DWisniewski, TRen, NBopp, CSok, ACai, TQStribling, SPai, LYMa, XMetzger, JVerras, AMcMasters, DChen, QTung, ETang, WSalituro, GBuist, NKuethe, JRivera, NClemas, JZhou, GGibson, JMaxwell, CALassman, MMcLaughlin, TCastro-Perez, JSzeto, DForrest, GHajdu, RRosenbach, MAli, A Discovery of Benzimidazole CYP11B2 Inhibitors with in Vivo Activity in Rhesus Monkeys. ACS Med Chem Lett6:573-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B2, mitochondrial
Name:Cytochrome P450 11B2, mitochondrial
Synonyms:Aldosterone Synthase (CYP11B2) | Aldosterone synthase | Aldosterone-synthesizing enzyme | CYPXIB2 | Cytochrome P450 11B2 | Cytochrome P450 11B2 (CYP11B2) | P-450Aldo | P-450C18 | Steroid 18-hydroxylase
Type:Enzyme
Mol. Mass.:57582.15
Organism:Homo sapiens (human)
Description:n/a
Residue:503
Sequence:
MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQG
YEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRP
ERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQED
IKMVYSFILRPGTSPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092137
NameBDBM50092137
Synonyms:CHEMBL3582481
TypeSmall organic molecule
Emp. Form.C16H12F3N3
Mol. Mass.303.2818
SMILESCc1c(F)cncc1-c1nc2cc(F)c(F)cc2n1C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a