Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 1
LigandBDBM50093788
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502024
Ki 2.0±n/a nM
Citation Yoshida, YNaoe, YTerauchi, TOzaki, FDoko, TTakemura, ATanaka, TSorimachi, KBeuckmann, CTSuzuki, MUeno, TOzaki, SYonaga, M Discovery of (1R,2S)-2-{[(2,4-Dimethylpyrimidin-5-yl)oxy]methyl}-2-(3-fluorophenyl)-N-(5-fluoropyridin-2-yl)cyclopropanecarboxamide (E2006): A Potent and Efficacious Oral Orexin Receptor Antagonist. J Med Chem58:4648-64 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 1
Name:Orexin receptor type 1
Synonyms:Hypocretin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r
Type:Protein
Mol. Mass.:47554.50
Organism:Homo sapiens (Human)
Description:O43613
Residue:425
Sequence:
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50093788
NameBDBM50093788
Synonyms:CHEMBL3585957
TypeSmall organic molecule
Emp. Form.C23H22F2N4O2
Mol. Mass.424.4432
SMILESCc1ncc(OC[C@]2(C[C@H]2C(=O)Nc2cc(C)c(F)cn2)c2cccc(F)c2)c(C)n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a