Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPAK1
LigandBDBM50096231
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1499557
Ki 4.0±n/a nM
Citation Crawford, JJLee, WAliagas, IMathieu, SHoeflich, KPZhou, WWang, WRouge, LMurray, LLa, HLiu, NFan, PWCheong, JHeise, CERamaswamy, SMintzer, RLiu, YChao, QRudolph, J Structure-Guided Design of Group I Selective p21-Activated Kinase Inhibitors. J Med Chem58:5121-36 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PAK1
Name:PAK1
Synonyms:2.7.11.1 | Alpha-PAK | PAK-1 | Serine/threonine-protein kinase PAK 1 | Serine/threonine-protein kinase PAK 1/PAK 2/PAK 3 | p21-activated kinase 1 | p65-PAK
Type:n/a
Mol. Mass.:60640.15
Organism:Homo sapiens (Human)
Description:Q13153
Residue:545
Sequence:
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096231
NameBDBM50096231
Synonyms:CHEMBL3580975
TypeSmall organic molecule
Emp. Form.C19H19ClN8
Mol. Mass.394.861
SMILESCN(Cc1ccc2[nH]cnc2c1Cl)c1nccc(Nc2cc([nH]n2)C2CC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a