Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B/Inner centromere protein
LigandBDBM50277545
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502091
IC50 1500±n/a nM
Citation Sells, TBChau, REcsedy, JAGershman, REHoar, KHuck, JJanowick, DAKadambi, VJLeRoy, PJStirling, MStroud, SGVos, TJWeatherhead, GSWysong, DRZhang, MBalani, SKBolen, JBManfredi, MGClaiborne, CF MLN8054 and Alisertib (MLN8237): Discovery of Selective Oral Aurora A Inhibitors. ACS Med Chem Lett6:630-4 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B/Inner centromere protein
Name:Aurora kinase B/Inner centromere protein
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277545
NameBDBM50277545
Synonyms:4-(9-chloro-7-(2-fluoro-6-methoxyphenyl)-5H-benzo[c]pyrimido[4,5-e]azepin-2-ylamino)-2-methoxybenzoic acid | Alisertib | CHEMBL483158 | MLN8237 | US9346787, MLN8237
TypeSmall organic molecule
Emp. Form.C27H20ClFN4O4
Mol. Mass.518.924
SMILESCOc1cc(Nc2ncc3CN=C(c4cc(Cl)ccc4-c3n2)c2c(F)cccc2OC)ccc1C(O)=O |c:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a