Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-A
LigandBDBM50277545
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1502097
Ki 0.300000±n/a nM
Citation Sells, TBChau, REcsedy, JAGershman, REHoar, KHuck, JJanowick, DAKadambi, VJLeRoy, PJStirling, MStroud, SGVos, TJWeatherhead, GSWysong, DRZhang, MBalani, SKBolen, JBManfredi, MGClaiborne, CF MLN8054 and Alisertib (MLN8237): Discovery of Selective Oral Aurora A Inhibitors. ACS Med Chem Lett6:630-4 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-A
Name:Serine/threonine-protein kinase Aurora-A
Synonyms:Aurora Kinase A (Aurora-A) | Aurora kinase A | Aurora-family kinase 1 | Aurora/IPL1-related kinase 1 | Serine/threonine-protein kinase 6 | Serine/threonine-protein kinase Ayk1
Type:Enzyme
Mol. Mass.:44791.66
Organism:Mus musculus (mouse)
Description:n/a
Residue:395
Sequence:
MDRCKENCVSRPVKTTVPFGPKRVLVTEQIPSQNLGSASSGQAQRVLCPSNSQRVPSQAQ
KLGAGQKPAPKQLPAASVPRPVSRLNNPQKNEQPAASGNDSEKEQASLQKTEDTKKRQWT
LEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLR
HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS
KRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEK
VDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNAS
QRLTLAEVLEHPWIKANSSKPPTGHTSKEPTSKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277545
NameBDBM50277545
Synonyms:4-(9-chloro-7-(2-fluoro-6-methoxyphenyl)-5H-benzo[c]pyrimido[4,5-e]azepin-2-ylamino)-2-methoxybenzoic acid | Alisertib | CHEMBL483158 | MLN8237 | US9346787, MLN8237
TypeSmall organic molecule
Emp. Form.C27H20ClFN4O4
Mol. Mass.518.924
SMILESCOc1cc(Nc2ncc3CN=C(c4cc(Cl)ccc4-c3n2)c2c(F)cccc2OC)ccc1C(O)=O |c:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a